banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR51F2 Q8NH61 Y341S MTETSLSSQCFPMSVLNNTIAEPLIFLLMG ... hOR51F2_Y341S
homo sapiens OR1A1 Q9P1Q5 Y276L MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y276L
homo sapiens OR1A1 Q9P1Q5 Y276F MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y276F
homo sapiens OR13H1 Q8NG92 Y266S MAMDNVTAVFQFLLIGISNYPQWRDTFFTL ... hOR13H1_Y266S
mus musculus Olfr73 Q920P2 Y260F MTLSDGNHSGAVFTLLGFSDYPELTIPLFL ... Olfr73
homo sapiens OR2M3_OR2M3P_OR2M6 Q8NG83 Y259H MARENSTFNSDFILLGIFNHSPTHTFLFFL ... hOR2M3_Y259H
homo sapiens OR1A1 Q9P1Q5 Y258M MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y258M
homo sapiens OR1A1 Q9P1Q5 Y258F MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y258F
homo sapiens OR1A1 Q9P1Q5 Y251M MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y251M
homo sapiens OR1A1 Q9P1Q5 Y251F MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y251F
homo sapiens OR1A1 Q9P1Q5 Y250F MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_Y250F
homo sapiens OR2T3 Q8NH03 Y109H MCSGNQTSQNQTASTDFTLTGLFAESKHAA ... hOR2T3_Y109H
homo sapiens OR1N2 Q8NGR9 W37R MEGFYLRRSHELQGMGKPGRVNQTTVSDFL ... hOR1N2_W37R
homo sapiens OR2M3_OR2M3P_OR2M6 Q8NG83 V78I MARENSTFNSDFILLGIFNHSPTHTFLFFL ... hOR2M3_V78I
homo sapiens OR14I1_OR5BU1_OR5BU1P A6ND48 V36A_D50N_Y216C MDNLTKVTEFLLMEFSGIWELQVLHAGLFL ... hOR14I1_V36A_ D50N_ Y216C
homo sapiens OR52B6 Q8NGF0 V288I MAQVRALHKIMALFSANSIGAMNNSDTRIA ... hOR52B6_V288I
homo sapiens OR1A2 Q9Y585 V277T MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_V277T
homo sapiens OR1A1 Q9P1Q5 V254T MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_V254T
homo sapiens OR1S2 Q8NGQ3 V225T_G240R MKTLCSFLQISRNMHQENQTTITEFILLGL ... hOR1S2_V225T_G240R
bos taurus OR1A1C E1BBG9 V205I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_V205I_I277T
homo sapiens OR1A2 Q9Y585 V205I MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_V205I
mus musculus Olfr43 Q7TRX1 V205I MREENESSTTDFTLLGVTRQREQEYFFFIL ... Olfr43_V205I
bos taurus OR1A1C E1BBG9 V205I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_V205I
homo sapiens OR2M5_OR2M5P A3KFT3 V198I MAWENQTFNSDFILLGIFNHSPTHTFLFFL ... hOR2M5_V198I
mus musculus Olfr164 Q8VF87 V184F MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164_V184F
homo sapiens OR51I1 Q9H343 V164L MLGLNGTPFQPATLQLTGIPGIQTGLTWVA ... hOR51I1_V164L
homo sapiens OR10D3 Q8NH80 V134A_R197K MEVKNCCMVTEFILLGIPHTEGLEMTLFVL ... hOR10D3_V134A_ R197K
homo sapiens OR4C13 Q8NGP0 V133I MANRNNVTEFILLGLTENPKMQKIIFVVFS ... hOR4C13_V133I
homo sapiens OR7C1_OR7C4 O76099 V126I_E171K METGNQTHAQEFLLLGFSATSEIQFILFGL ... hOR7C1_V126I_E171K
mus musculus Olfr164 Q8VF87 V108T_E162D_V184F_I202L_L210I_ ... MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164_V108T_E162D_V184F_I202L_L210I_A279V