banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR8G5_OR8G5P_OR8G6 Q8NG78 M1-_I2-_I3-_Y4-_K5-_Q6-_G7-_I8 ... MAAENHSFVTKFILVGLTEKSELQLPLFLV ... hOR8G5
mus musculus Olfr160 Q8VGE3 MAAENQSTVTEFILRGLTNRPELQLPLLLL ... Olfr160
homo sapiens OR8B8 Q15620 MAAENSSFVTQFILAGLTDQPGVQIPLFFL ... hOR8B8
homo sapiens OR8B8 Q15620 L101P MAAENSSFVTQFILAGLTDQPGVQIPLFFL ... hOR8B8_L101P
homo sapiens OR8A1 Q8NGG7 T116R_A273V_M1-_G2-_F3-_L4-_S5 ... MAAGNHSTVTEFILKGLTKRADLQLPLFLL ... hOR8A1
homo sapiens OR8B12 Q8NGG6 MAAKNSSVTEFILEGLTHQPGLRIPLFFLF ... hOR8B12
homo sapiens OR5J2 Q8NH18 MADDNFTVVTEFILLGLTDHAELKAVLFVV ... hOR5J2
vulpes vulpes OR5K1 A0A3Q7SVK8 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... vvOR5K1
canis lupus familiaris OR5K1 A0A8P0TCS6 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... clOR5K1
homo sapiens OR5K1 Q8NHB7 MAEENHTMKNEFILTGFTDHPELKTLLFVV ... hOR5K1
homo sapiens OR5K1 Q8NHB7 F62L MAEENHTMKNEFILTGFTDHPELKTLLFVV ... hOR5K1_F62L
puma concolor OR5K1 A0A6P6H1F7 MAEENHTMKSEFILTGFTDHPELKTLLFLV ... pcOR5K1
homo sapiens OR5AC1_OR5AC1P P0C628 MAEENKILVTHFVLTGLTDHPGLQAPLFLV ... hOR5AC1
homo sapiens OR9Q1 Q8NGQ5 MAEMNLTLVTEFLLIAFTEYPEWALPLFLL ... hOR9Q1
homo sapiens OR9Q1 Q8NGQ5 A83T MAEMNLTLVTEFLLIAFTEYPEWALPLFLL ... hOR9Q1_A83T
mus musculus Olfr202 Q8VGQ3 MAERNWTLVTEFVLTGLTERPELQVPLFLV ... MOR182-1
homo sapiens OR9Q2_OR9Q2P Q8NGE9 MAERNYTVVTEFFLTAFTEHLQWRVPLFLI ... hOR9Q2
homo sapiens OR9Q2_OR9Q2P Q8NGE9 C179R MAERNYTVVTEFFLTAFTEHLQWRVPLFLI ... hOR9Q2_C179R
homo sapiens OR52W1_OR52W1P Q6IF63 MAETLQLNSTFLHPNFFILTGFPGLGSAQT ... hOR52W1
homo sapiens OR52W1_OR52W1P Q6IF63 H239R_L254Q MAETLQLNSTFLHPNFFILTGFPGLGSAQT ... hOR52W1_H239R_L254Q
homo sapiens OR52W1_OR52W1P Q6IF63 L254Q MAETLQLNSTFLHPNFFILTGFPGLGSAQT ... hOR52W1
homo sapiens OR8U3_OR5R1_OR5R1P Q8NH85 MAEVNIIYVTVFILKGITNRPELQAPCFGV ... hOR5R1
homo sapiens OR8U3_OR5R1_OR5R1P Q8NH85 C122R_S128G_F184L MAEVNIIYVTVFILKGITNRPELQAPCFGV ... hOR5R1_C122R_S128G_F184L
homo sapiens OR8U3_OR5R1_OR5R1P Q8NH85 C122R_A274V_I320G_Y324- MAEVNIIYVTVFILKGITNRPELQAPCFGV ... hOR5R1
mus musculus Olfr488 Q8VG02 MAFLDNGNHTAVTEFILLGLTDDPFLRIVL ... Olfr600
homo sapiens OR10P1_OR10P1P_OR10P2P_OR10P3P Q8NGE3 P313- MAGENHTTLPEFLLLGFSDLKALQGPLFWV ... hOR10P1
homo sapiens OR10P1_OR10P1P_OR10P2P_OR10P3P Q8NGE3 MAGENHTTLPEFLLLGFSDLKALQGPLFWV ... hOR10P1
homo sapiens OR10P1_OR10P1P_OR10P2P_OR10P3P Q8NGE3 R195K MAGENHTTLPEFLLLGFSDLKALQGPLFWV ... hOR10P1_R195K
homo sapiens OR8I2 Q8N0Y5 MAGNNFTEVTVFILSGFANHPELQVSLFLM ... hOR8I2
homo sapiens OR8I2 Q8N0Y5 +311E_+312R_+313P_+314L_+315E_ ... MAGNNFTEVTVFILSGFANHPELQVSLFLM ... hOR8I2