banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
vulpes vulpes OR5K1 A0A3Q7SVK8 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... vvOR5K1
rattus norvegicus Olfr226 P23270 MERRNHSGRVSEFVLLGFPAPAPLRVLLFF ... Olr226
puma concolor OR5K1 A0A6P6H1F7 MAEENHTMKSEFILTGFTDHPELKTLLFLV ... pcOR5K1
pongo abelii OR5AN1 A0A6D2VXZ9 G4E_G5R_I7S_E9R_Y12K_D20E_R23K ... MTGERNSTRITKFILLGFSEFPKHTIFLFS ... Poab_5AN2
pongo abelii OR5AN1 A0A6D2VXZ9 MTGGGNITEITYFILLGFSDFPRIITVLFT ... Poab_5AN1
pan troglodytes OR5K1 A0A2J8MY22 MTEENHTMKNEFILMGFTDHPELKTLLFVV ... ptOR5K1
pan troglodytes OR2M3 A0A2J8KNW9 MARENSTFNSDFLLLGIFNHSPTHTFLFFL ... ptOR2M3
pan troglodytes OR5AN1 H2R7S9 W3G_G4E_G5R_I7S_E9R_Y12K_D20E_ ... MTGERNSTRITKFILLGFSEFPKNPIFLFS ... Patr_5AN2
pan troglodytes OR1A1 Q9TUA7 MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... ptOR1A1
pan troglodytes OR7D4 D1MFA5 MEAENLTELSKFLLLGLSDDPELQPILFGL ... ptOR7D4
pan paniscus OR5K1 A0A2R8ZIW4 MTEENHTMKNEFILMGFTDHPELKTLLFVV ... ppOR5K1
pan paniscus OR2M3 A0A2R8ZMP6 MARENSTFNSDFLLLGIFNHSPTHTFLFFL ... ppOR2M3
ovis aries OR5K1 A0A6P3DZI2 MAKENHTIKNEFILTGFTDHPELKTLLFVV ... oaOR5K1
mus musculus Olfr175_Olfr175 A0A140T8K4 MTEDNYSLTTEFILIGFSDHPDLKILLFLV ... Olfr175
mus musculus Olfr1440 Q8VFV4 MPGGRNSTVITKFILVGFSDFPKLKLVLFV ... mOR215-1
mus musculus Olfr180 Q7TS48 MEKTNHSLTTQFILVGFSDHPDLKTPLFLL ... Olfr180
mus musculus Olfr544 E9PX47 MSGWSNGTYNESYTSFLLMGFPGMQEARAL ... Olfr544
mus musculus Olfr690 Q8VH18 MLGTNFTIIHPTVFILLGIPGLEQYHTWLS ... Olfr690
mus musculus Olfr672 Q8VG28 MSPGNSSWIHPSSFLLLGIPGLEELQFWLG ... Olfr672
mus musculus Olfr545 Q9WU94 MLGWSNGTYNESYTSFLLMGFPGMQEARAL ... Olfr545
mus musculus Olfr16 Q62007 MQRNNFTEVIEFVFLGFSSFGKHQITLFVV ... Olfr16
mus musculus Olfr235 E9Q9Z6 MIGERNITKITQFILLGFSDFPRITVPLFV ... MOR214-3
mus musculus Olfr173 E9QAT7 MVEENHTMKREFVLTGFTDHPEMKGLLFAV ... Olfr173
mus musculus Olfr547_Olfr548 E9PXN3 MTTLNYTVVSHTVFHLLGIPGLEDQHMWIS ... Olfr547
mus musculus Olfr691 Q8VGW5 MIHSNITPIHPAFFVLVGIPGLEAYHTWLS ... Olfr691
mus musculus Olfr164 Q8VF87 MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164
mus musculus Olfr164 Q8VF87 V108T MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164_V108T
mus musculus Olfr164 Q8VF87 E162D MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164_E162D
mus musculus Olfr164 Q8VF87 V184F MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164_V184F
mus musculus Olfr164 Q8VF87 I202L MLMIQWNNWTRNSDFILLGLFDHSPLHTFF ... Olfr164_I202L