banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR1A2 Q9Y585 MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2
homo sapiens OR1A2 Q9Y585 A108G MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G
homo sapiens OR1A2 Q9Y585 K109N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_K109N
homo sapiens OR1A2 Q9Y585 A108G_K109N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N
homo sapiens OR1A2 Q9Y585 T154A_S155N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_T154A_S155N
homo sapiens OR1A2 Q9Y585 V205I MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_V205I
homo sapiens OR1A2 Q9Y585 T254V MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_T254V
homo sapiens OR1A2 Q9Y585 V277T MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_V277T
homo sapiens OR1A2 Q9Y585 A108G_K109N_T154A_S155N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_T154A_S155N
homo sapiens OR1A2 Q9Y585 A108G_K109N_T154A MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_T154A
homo sapiens OR1A2 Q9Y585 A108G_K109N_S155N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_S155N
homo sapiens OR1A2 Q9Y585 A108G_T154A_S155N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_T154A_S155N
homo sapiens OR1A2 Q9Y585 K109N_T154A_S155N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_K109N_T154A_S155N
homo sapiens OR1A2 Q9Y585 T154A MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_T154A
homo sapiens OR1A2 Q9Y585 S155N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_S155N
homo sapiens OR1A2 Q9Y585 A108G_V205I MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_V205I
homo sapiens OR1A2 Q9Y585 A108G_K109N_V205I MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_V205I
homo sapiens OR1A2 Q9Y585 A108G_K109N_T254V MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_T254V
homo sapiens OR1A2 Q9Y585 A108G_K109N_V205I_T254V MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_V205I_T254V
homo sapiens OR1A2 Q9Y585 A108G_K109N_V205I_V277T MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_V205I_V277T
homo sapiens OR1A2 Q9Y585 A108G_K109N_T254V_V277T MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_T254V_V277T
homo sapiens OR1A2 Q9Y585 A108G_K109N_V205I_T254V_V277T MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G_K109N_V205I_T254V_V277T
homo sapiens OR10H1 Q9Y4A9 MQRANHSTVTQFILVGFSVFPHLQLMLFLL ... hOR10H1
mus musculus Olfr64 Q9WVN5 MWSNISAAPFLLTGFPGLEAAHHWISIPFF ... MOR1-1
mus musculus Olfr67 Q9WVD9 MKVASSFHNDTNPQDVWYVLIGIPGLEDLH ... MOR31-1
mus musculus Olfr69 Q9WVD7 MIKFNGSVFMPSVLTLVGIPGLESVQCWIG ... Olfr69
mus musculus Olfr545 Q9WU94 MLGWSNGTYNESYTSFLLMGFPGMQEARAL ... Olfr545
mus musculus Olfr749 Q7TRL6 +1M_+2S_+3L_+4F_+5P_+6Q_+7R_+8 ... MSLFPQRNLDAMNRSAAHVTEFVLLGFPGS ... MOR106-1
homo sapiens OR14J1_OR5U1 Q9UGF5 MVNLTSMSGFLLMGFSDERKLQILHALVFL ... hOR14J1
pan troglodytes OR1A1 Q9TUA7 MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... ptOR1A1