banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
mus musculus Olfr1016 A2ASV2 MERGNHTVSEFILLGFTSDPTTQLVLFVMF ... Olfr1016
mus musculus Olfr1019 Q8VGS3 MDKENHSVVTEFVFMGITQDPQLQIIFFVV ... MOR180-1
mus musculus Olfr1032 A2ATE5 MLNFTDVTEFILLGLTSRKELQVLFFVIFL ... Olfr1032
mus musculus Olfr1046 Q7TR79 MEKSNHSARIQVTEFILLGLTNNPGLKAPL ... Olfr1046
mus musculus Olfr1057 Q7TR75 MATGNLTHVTEFILMGVSDRPELQVPLFFL ... Olfr1057
mus musculus Olfr1057_Olfr1062 Q7TR71 MATGNLTHVTEFILMGVTDRPELQVPLFFL ... MOR185-1
mus musculus Olfr1079 Q8VF52 MQMESQNLTVVTEFILRGITDRPELQVPLF ... MOR189-1
mus musculus Olfr109 Q8VG96 MENSTSVDEFLLLGLTSVQKLQPIIFVMFL ... MOR250-1
mus musculus Olfr1097_Olfr1098 A2AVA9 MSACNDTNEPEFTLVGLTDSKEIQLVLSVL ... Olfr1097
mus musculus Olfr1098 A2AVB0 MSACNPTNEPEFMLVGLTDSKEIQLVLSVL ... Olfr1098
mus musculus Olfr1104 A2AVB5 MTENNFTKVTVFMFSGFSDHPELQVSLFLI ... MOR207-1
mus musculus Olfr1156 A2AVC3 MEEVNCTFMAEFILLGFSDVPELAIFLFLV ... Olfr1156
mus musculus Olfr1324 Q8VEU7 MLPFNDEDEFSLFRYSRTMHQGNQTAISGF ... MOR128-2
mus musculus Olfr1325 Q8VF43 MKKMNYQEIGNYTKVTEFILVGLSRHPTSQ ... Olfr1325
mus musculus Olfr1328 A7MAY4 L48M_C65S_Y74F_G97S_W99C_Y103F MIPGQNQSWVSEFILIGFSSDPTTNSILFI ... MOR259-1
mus musculus Olfr1341 Q7TQV4 MQGPNQTFVTEFILLGFSLSPRTTPLLFSA ... MOR258-1
mus musculus Olfr1352 Q8VGX5 MEPRNNTHILEFFLLGFSQDPNLQPVICGL ... MOR139-1
mus musculus Olfr1356 Q7TQU8 MERENQTGERNFLLLGFTEDSDLQSFFFGL ... Olfr1356
mus musculus Olfr1377 Q8VGH1 MDGDNETMVAEFLLLGLSGKSEQEEVVFGM ... MOR129-1
mus musculus Olfr1395 Q8VGD7 MAWAGNQTLISHFVLLGLFTHSPLHLFLFS ... MOR277-1
mus musculus Olfr1413 Q8VGU3 MATQVHRNGSLSAVSLQGFVLVGFGGGAKT ... Olfr1413
mus musculus Olfr1426 Q8VG74 MENYTRVKELIFLGLTQSQEVSMVLFLFLL ... Mor239-1
mus musculus Olfr1433_Olfr1434 Q7TQR9 MIGGRNITKITQFILLGFSDFPQITALLFV ... mOR214-4
mus musculus Olfr1436 A0PK57 MEAMIKGKNITEITEFILLGFSDFPQITAL ... mOR214-2
mus musculus Olfr1437 Q7TQR7 MIKERNFTEITEFILLGFSDFPQITALLFV ... mOR214-6
mus musculus Olfr1440 Q8VFV4 MPGGRNSTVITKFILVGFSDFPKLKLVLFV ... mOR215-1
mus musculus Olfr1441 Q8VFV3 MAVGRNISVVTNFILLGFLERPQLQIVLFV ... Mor215-2
mus musculus Olfr1442 Q8VFW7 MENRTEMTGFILLGLTNAPELRAPLFIIIS ... Mor202-9
mus musculus Olfr147 Q60886 MISMLAGNGSSVTEFVLAGLTDRPELQLPL ... Olfr147
mus musculus Olfr1487 Q8VFQ6 MIQNISELSEFILVGLTDAPFLQIPLFIIF ... Olfr1487