banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR9Q2_OR9Q2P Q8NGE9 C135R_M1-_A2-_E3-_R4-_N5-_Y6-_ ... MILLIRGDRRLHTPMYFFLSHLSLVDICYS ... hOR9Q2_C179R
homo sapiens OR9Q2_OR9Q2P Q8NGE9 MAERNYTVVTEFFLTAFTEHLQWRVPLFLI ... hOR9Q2
homo sapiens OR9Q2_OR9Q2P Q8NGE9 C179R MAERNYTVVTEFFLTAFTEHLQWRVPLFLI ... hOR9Q2_C179R
homo sapiens OR9Q2 A0A126GVG4 MRGWNHTGAKEFLLVGLTENPNLQIPLFLL ... hOR9Q2
homo sapiens OR9Q1 Q8NGQ5 M1-_A2-_E3- MNLTLVTEFLLIAFTEYPEWALPLFLLFLF ... hOR9Q1_A2V
homo sapiens OR9Q1 Q8NGQ5 MAEMNLTLVTEFLLIAFTEYPEWALPLFLL ... hOR9Q1
homo sapiens OR9Q1 Q8NGQ5 A83T MAEMNLTLVTEFLLIAFTEYPEWALPLFLL ... hOR9Q1_A83T
homo sapiens OR9K2 Q8NGE7 MLGSKPRVHLYILPCASQQVSTMGDRGTSN ... hOR9K2
homo sapiens OR9K2 Q8NGE7 R207H MLGSKPRVHLYILPCASQQVSTMGDRGTSN ... hOR9K2_R207H
homo sapiens OR9I1 Q8NGQ6 MAKNNLTRVTEFILMGFMDHPKLEIPLFLV ... hOR9I1
homo sapiens OR9G9 P0C7N8 C193G MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1
homo sapiens OR9G9 A0A126GVJ5 MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G9
homo sapiens OR9G9 P0C7N8 V28L_I83T_C193G MQRSNHTVTEFILLGFTTDPGMQLGLFLVF ... hOR9G1
homo sapiens OR9G9 P0C7N8 MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G9
homo sapiens OR9G4 Q8NGQ1 N206D MIFPSHDSQAFTSVDMEVGNCTILTEFILL ... hOR9G4_N191D
homo sapiens OR9G4 Q8NGQ1 MIFPSHDSQAFTSVDMEVGNCTILTEFILL ... hOR9G4
homo sapiens OR9G4 Q8NGQ1 N206D_V222A MIFPSHDSQAFTSVDMEVGNCTILTEFILL ... hOR9G4_N206D_ V222A
homo sapiens OR9G4 Q8NGQ1 H6Y_N206D_V222A MIFPSYDSQAFTSVDMEVGNCTILTEFILL ... hOR9G4_H6Y_ N206D_ V222A
homo sapiens OR9G1_OR9G5 Q8NH87 MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1
homo sapiens OR9G1_OR9G5 Q8NH87 C53R_T62I_C98G MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1_C53R_T62I_C98G
homo sapiens OR9G1_OR9G5 Q8NH87 C53R_T62I_C98G_A259S MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1_C53R_T62I_C98G_A259S
homo sapiens OR9G1_OR9G5 Q8NH87 F61V_T62V_L303I MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1
homo sapiens OR9G1_OR9G5 Q8NH87 C53R_T62I MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1_C53R_T62I
homo sapiens OR9A4 Q8NGU2 MLMNYSSATEFYLLGFPGSEELHHILFAIF ... hOR9A4
homo sapiens OR9A2 Q8NGT5 R298Q MMDNHSSATEFHLLGFPGSQGLHHILFAIF ... hOR9A2
homo sapiens OR9A2 Q8NGT5 MMDNHSSATEFHLLGFPGSQGLHHILFAIF ... hOR9A2
homo sapiens OR9A2 Q8NGT5 C304Y MMDNHSSATEFHLLGFPGSQGLHHILFAIF ... hOR9A2_C304Y
homo sapiens OR8U9 P0C7N5 Q293R MTQINCTQVTEFILVGLTDRQELKMPLFVL ... hOR8U9
homo sapiens OR8U9 P0C7N5 MTQINCTQVTEFILVGLTDRQELKMPLFVL ... hOR8U9
homo sapiens OR8U9 P0C7N5 T2A_Q3H_Q293R MAHINCTQVTEFILVGLTDRQELKMPLFVL ... hOR8U9_T2A_ Q3H_ Q293R