banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
bos taurus OR1A1C E1BBG9 MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1
bos taurus OR1A1C E1BBG9 I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_I277T
bos taurus OR1A1C E1BBG9 L105I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I
bos taurus OR1A1C E1BBG9 L105I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I_I277T
bos taurus OR1A1C E1BBG9 L105I_V205I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I_V205I
bos taurus OR1A1C E1BBG9 L105I_V205I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I_V205I_I277T
bos taurus OR1A1C E1BBG9 V205I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_V205I
bos taurus OR1A1C E1BBG9 V205I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_V205I_I277T
bos taurus OR5K1 E1BM68 MAKENHTIKSEFILTGFTDHPELKTLLFVV ... btOR5K1
canis lupus familiaris OR5K1 A0A8P0TCS6 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... clOR5K1
homo sapiens OR10A2_OR10A2P Q9H208 D167G_I240T MSFSSLPTEIQSLLFLTFLTIYLVTLMGNC ... hOR10A2
homo sapiens OR10A2_OR10A2P Q9H208 MSFSSLPTEIQSLLFLTFLTIYLVTLMGNC ... hOR10A2
homo sapiens OR10A2_OR10A2P Q9H208 H43R_H207R_K258T MSFSSLPTEIQSLLFLTFLTIYLVTLMGNC ... hOR10A2_H43R_ H207R_ K258T
homo sapiens OR10A5_OR10A1 Q9H207 E8R_K41M_S44C_H57R_K187R_H236N ... MAIGNWTRISEFILMSFSSLPTEIQSLLFL ... hOR10A2_H43R_H207R_K258T
homo sapiens OR10A3 P58181 MKRQNQSCVVEFILLGFSNFPELQVQLFGV ... hOR10A3
homo sapiens OR10A3 P58181 C8G MKRQNQSGVVEFILLGFSNFPELQVQLFGV ... hOR10A3_C8G
homo sapiens OR10A4_OR10A4P Q9H209 MMWENWTIVSEFVLVSFSALSTELQALLFL ... hOR10A4
homo sapiens OR10A4_OR10A4P Q9H209 R261Q_M1- MWENWTIVSEFVLVSFSALSTELQALLFLL ... hOR10A4_R262Q
homo sapiens OR10A5_OR10A1 Q9H207 MAIGNWTEISEFILMSFSSLPTEIQSLLFL ... hOR10A5
homo sapiens OR10A6 Q8NH74 MERQNQSCVVEFILLGFSNYPELQGQLFVA ... hOR10A6
homo sapiens OR10A6 Q8NH74 A117V_V140G_L287P MERQNQSCVVEFILLGFSNYPELQGQLFVA ... hOR10A6_A117V_V140G_L287P
homo sapiens OR10A6 Q8NH74 L287P MERQNQSCVVEFILLGFSNYPELQGQLFVA ... hOR10A6_L287P
homo sapiens OR10A6 Q8NH74 V140G_L287P MERQNQSCVVEFILLGFSNYPELQGQLFVA ... hOR10A6_V140G_L287P
homo sapiens OR10A7 Q8NGE5 MICENHTRVTEFILLGFTNNPEMQVSLFIF ... hOR10A7
homo sapiens OR10AC1_OR10AC1P Q8NH08 MDSPSNATVPCGFLLQGFSEFPHLRPVLFL ... hOR10AC
homo sapiens OR10AD1_OR10AD1P Q8NGE0 MLRNGSIVTEFILVGFQQSSTSTRALLFAL ... hOR10AD1
homo sapiens OR10AD1_OR10AD1P Q8NGE0 G65C MLRNGSIVTEFILVGFQQSSTSTRALLFAL ... hOR10AD1_G65C
homo sapiens OR10AD1_OR10AD1P Q8NGE0 R166Q_S177N_W198R MLRNGSIVTEFILVGFQQSSTSTRALLFAL ... hOR10AD1_R166Q_S177N_W198R
homo sapiens OR10AG1 Q8NH19 MEFVLLGFSDIPNLHWMLFSIFLLMYLMIL ... hOR10AG1
homo sapiens OR10C1_OR10C2 Q96KK4 MSANTSMVTEFLLLGFSHLADLQGLLFSVF ... hOR10C1