banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
bos taurus OR5K1 E1BM68 MAKENHTIKSEFILTGFTDHPELKTLLFVV ... btOR5K1
bos taurus OR1A1C E1BBG9 MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1
bos taurus OR1A1C E1BBG9 L105I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I
bos taurus OR1A1C E1BBG9 V205I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_V205I
bos taurus OR1A1C E1BBG9 I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_I277T
bos taurus OR1A1C E1BBG9 L105I_V205I MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I_V205I
bos taurus OR1A1C E1BBG9 L105I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I_I277T
bos taurus OR1A1C E1BBG9 V205I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_V205I_I277T
bos taurus OR1A1C E1BBG9 L105I_V205I_I277T MREDNQSSTLDFILLGVSGQQEEEDVFFIL ... btOR1A1_L105I_V205I_I277T
canis lupus familiaris OR5K1 A0A8P0TCS6 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... clOR5K1
homo sapiens OR10S1 Q8NGN2 MTSRSVCEKMTMTTENPNQTVVSHFFLEGL ... OR10S1
homo sapiens OR2A1 Q8NGT9 MGENQTMVTEFLLLGFLLGPRIQMLLFGLF ... OR2A42
homo sapiens OR2A7 Q96R45 MGDNITSITEFLLLGFPVGPRIQMLLFGLF ... OR2A7
homo sapiens OR2L13_OR2L14 Q8N349 MEKWNHTSNDFILLGLLPPNQTGIFLLCLI ... OR2L13
homo sapiens OR5AN1 Q8NGI8 MTGGGNITEITYFILLGFSDFPRIIKVLFT ... hOR5AN1
homo sapiens OR2T4 Q8NH00 MDNITWMASHTGWSDFILMGLFRQSKHPMA ... OR2T4
homo sapiens OR2W3_OR2W3P_OR2W8P Q7Z3T1 MDGTNGSTQTHFILLGFSDRPHLERILFVV ... OR2W3
homo sapiens OR51B5 Q9H339 MSSSGSSHPFLLTGFPGLEEAHHWISVFFL ... OR51B5
homo sapiens OR10K1 Q8NGX5 MEQVNKTVVREFVVLGFSSLARLQQLLFVI ... hOR10K1
homo sapiens OR6Y1_OR6Y2 Q8NGX8 V252I MTTIILEVDNHTVTTRFILLGFPTRPAFQL ... hOR6Y1_V252I
homo sapiens OR10Z1 Q8NGY1 MGQTNVTSWRDFVFLGFSSSGELQLLLFAL ... hOR10Z1
homo sapiens OR6N2 Q8NGY6 MDQYNHSSLAEFVFLGFASVGYVRGWLFVL ... hOR6N2
homo sapiens OR14C36_OR5BF1 Q8NHC7 G225R_D231Y MPNSTTVMEFLLMRFSDVWTLQILHSASFF ... hOR14C36_G225R_D231Y
homo sapiens OR14L1_OR14L1P_OR5AV1P Q8NHC6 M1-_S2-_P3-_D4-_T5-_F6-_L7-_K8 ... MGFSNSWDIQIVHAALFFLVYLAAVIGNLL ... hOR14L1
homo sapiens OR14A16 A0A126GV53 MANLTIVTEFILMGFSTNKNMCILHSILFL ... hOR14A16_Indel
homo sapiens OR11L1 Q8NGX0 G108S_F117L_A142T_R171P MEPQNTSTVTNFQLLGFQNLLEWQALLFVI ... hOR11L1_G108S_F117L_A142T_R171P
homo sapiens OR4A5 Q8NH83 T8S_Y33H_D46T_M57V_G82D_F84L_Q ... MRQNNNISEFVLLGFSQDPGVQKALFVMFL ... hOR1S2
homo sapiens OR10T2 Q8NGX3 MRGFNKTTVVTQFILVGFSSLGELQLLLFV ... hOR10T2
homo sapiens OR2T29 Q8NH02 Q24R_F154S_V229I_E236A MANITRMANHTGRLDFILMGLFRRSKHPAL ... hOR2T5
homo sapiens OR6P1 Q8NGX9 MRNLSGGHVEEFVLVGFPTTPPLQLLLFVL ... hOR6P1