banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR10K1 Q8NGX5 MEQVNKTVVREFVVLGFSSLARLQQLLFVI ... hOR10K1
homo sapiens OR6Y1_OR6Y2 Q8NGX8 V252I MTTIILEVDNHTVTTRFILLGFPTRPAFQL ... hOR6Y1_V252I
homo sapiens OR10Z1 Q8NGY1 MGQTNVTSWRDFVFLGFSSSGELQLLLFAL ... hOR10Z1
homo sapiens OR6N2 Q8NGY6 MDQYNHSSLAEFVFLGFASVGYVRGWLFVL ... hOR6N2
homo sapiens OR14C36_OR5BF1 Q8NHC7 G225R_D231Y MPNSTTVMEFLLMRFSDVWTLQILHSASFF ... hOR14C36_G225R_D231Y
homo sapiens OR14L1_OR14L1P_OR5AV1P Q8NHC6 M1-_S2-_P3-_D4-_T5-_F6-_L7-_K8 ... MGFSNSWDIQIVHAALFFLVYLAAVIGNLL ... hOR14L1
homo sapiens OR14A16 A0A126GV53 MANLTIVTEFILMGFSTNKNMCILHSILFL ... hOR14A16_Indel
homo sapiens OR11L1 Q8NGX0 G108S_F117L_A142T_R171P MEPQNTSTVTNFQLLGFQNLLEWQALLFVI ... hOR11L1_G108S_F117L_A142T_R171P
homo sapiens OR4A5 Q8NH83 T8S_Y33H_D46T_M57V_G82D_F84L_Q ... MRQNNNISEFVLLGFSQDPGVQKALFVMFL ... hOR1S2
homo sapiens OR10T2 Q8NGX3 MRGFNKTTVVTQFILVGFSSLGELQLLLFV ... hOR10T2
homo sapiens OR2T29 Q8NH02 Q24R_F154S_V229I_E236A MANITRMANHTGRLDFILMGLFRRSKHPAL ... hOR2T5
homo sapiens OR6P1 Q8NGX9 MRNLSGGHVEEFVLVGFPTTPPLQLLLFVL ... hOR6P1
homo sapiens OR13G1 Q8NGZ3 I132V MNHSVVTEFIILGLTKKPELQGIIFLFFLI ... hOR13G1_I132V
homo sapiens OR10J5 Q8NHC4 MKRKNFTEVSEFIFLGFSSFGKHQITLFVV ... hOR10J5
homo sapiens OR6N1 Q8NGY5 I194T_F245L_Q261R_R293H MDTGNWSQVAEFIILGFPHLQGVQIYLFLL ... hOR6N1_I194T_F245L_Q261R_R293H
homo sapiens OR6F1 Q8NGZ6 MDTGNKTLPQDFLLLGFPGSQTLQLSLFML ... hOR6F1
homo sapiens OR10K2 Q6IF99 MERVNETVVREVIFLGFSSLARLQQLLFVI ... hOR10K2
homo sapiens OR6K2 Q8NGY2 MESPNRTTIQEFIFSAFPYSWVKSVVCFVP ... hOR6K2
homo sapiens OR14A2_OR5AX1_OR5AX1P Q96R54 I314- MANVTLVTGFLLMGFSNIQKLRILYGVLFL ... hOR14A2
homo sapiens OR14K1_OR5AY1 Q8NGZ2 M312R_+315L MTNQTQMMEFLLVRFTENWVLLRLHALLFS ... hOR14K1
homo sapiens OR1C1 Q15619 MEKRNLTVVREFVLLGLPSSAEQQHLLSVL ... hOR1C1
homo sapiens OR6K3 Q8NGY3 T4A_P244S_P264L MCWAMPSPFTGSSTRNMESGNQSTVTEFIF ... hOR6K3_P228S_P248L
homo sapiens OR2T10 Q8NGZ9 MRLANQTLGGDFFLLGIFSQISHPGRLCLL ... hOR2T10
homo sapiens OR2T34 Q8NGX1 +1M_+2T_+3F_+4F_+5S_+6S_+7G_+8 ... MTFFSSGGNCEPVMCSGNQTSQNQTASTDF ... hOR2T34
homo sapiens OR2T11 Q8NH01 C119R_Q309R MTNTSSSDFTLLGLLVNSEAAGIVFTVILA ... hOR2T11_C119R_Q309R
homo sapiens OR2M4 Q96R27 MVWENQTFNSIFILLGIFNHSPTHTFLFSL ... hOR2M4
homo sapiens OR2M3_OR2M3P_OR2M6 Q8NG83 MARENSTFNSDFILLGIFNHSPTHTFLFFL ... hOR2M3
homo sapiens OR5H2 Q8NGV7 E16Q_I286V_+315C_+316G_+317R_+ ... MSNEDMEQDNTTLLTQFVLTGLTYQPEWKM ... hOR5H2
homo sapiens OR5H6 A0A126GV91 MFLYLCFIFQRTCSEEMEEENATLLTEFVL ... hOR5H6
homo sapiens OR2V2_OR2V3 Q96R30 H221R METWVNQSYTDGFFLLGIFSHSTADLVLFS ... hOR2V2_H221R