banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
vulpes vulpes OR5K1 A0A3Q7SVK8 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... vvOR5K1
pan troglodytes OR7D4 D1MFA5 MEAENLTELSKFLLLGLSDDPELQPILFGL ... ptOR7D4
pan troglodytes OR5K1 A0A2J8MY22 MTEENHTMKNEFILMGFTDHPELKTLLFVV ... ptOR5K1
pan troglodytes OR2M3 A0A2J8KNW9 MARENSTFNSDFLLLGIFNHSPTHTFLFFL ... ptOR2M3
pan troglodytes OR1A1 Q9TUA7 MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... ptOR1A1
pan paniscus OR5K1 A0A2R8ZIW4 MTEENHTMKNEFILMGFTDHPELKTLLFVV ... ppOR5K1
pan paniscus OR2M3 A0A2R8ZMP6 MARENSTFNSDFLLLGIFNHSPTHTFLFFL ... ppOR2M3
pongo abelii OR5AN1 A0A6D2VXZ9 G4E_G5R_I7S_E9R_Y12K_D20E_R23K ... MTGERNSTRITKFILLGFSEFPKHTIFLFS ... Poab_5AN2
pongo abelii OR5AN1 A0A6D2VXZ9 MTGGGNITEITYFILLGFSDFPRIITVLFT ... Poab_5AN1
puma concolor OR5K1 A0A6P6H1F7 MAEENHTMKSEFILTGFTDHPELKTLLFLV ... pcOR5K1
pan troglodytes OR5AN1 H2R7S9 W3G_G4E_G5R_I7S_E9R_Y12K_D20E_ ... MTGERNSTRITKFILLGFSEFPKNPIFLFS ... Patr_5AN2
homo sapiens OR8G2P Q6IF36 MVFLSSVETDQRKMSAGNHSSVTEFILAGL ... OR8G2
homo sapiens OR51B5 Q9H339 MSSSGSSHPFLLTGFPGLEEAHHWISVFFL ... OR51B5
homo sapiens OR2W3_OR2W3P_OR2W8P Q7Z3T1 MDGTNGSTQTHFILLGFSDRPHLERILFVV ... OR2W3
homo sapiens OR2T4 Q8NH00 MDNITWMASHTGWSDFILMGLFRQSKHPMA ... OR2T4
homo sapiens OR2L13_OR2L14 Q8N349 MEKWNHTSNDFILLGLLPPNQTGIFLLCLI ... OR2L13
homo sapiens OR2A7 Q96R45 MGDNITSITEFLLLGFPVGPRIQMLLFGLF ... OR2A7
homo sapiens OR2A1 Q8NGT9 MGENQTMVTEFLLLGFLLGPRIQMLLFGLF ... OR2A42
homo sapiens OR1L6_OR1L7 Q8NGR2 Q59K MSYFYRLKLMKEAVLVKLPFTSLPLLLQTL ... OR1L6
homo sapiens OR10S1 Q8NGN2 MTSRSVCEKMTMTTENPNQTVVSHFFLEGL ... OR10S1
rattus norvegicus Olfr226 P23270 MERRNHSGRVSEFVLLGFPAPAPLRVLLFF ... Olr226
mus musculus Olfr994 Q8VF73 MTQGNGTEVTDFYLLGFGVERDIQCVLFIV ... Olfr994
mus musculus Olfr992 Q8VGC6 MKHSNDSKVTEFILLGFAGQNESWHILFVV ... Olfr992
mus musculus Olfr988 Q7TRA1 MEQSNDTKVTEFILLGFSGQHKSWHILFII ... Olfr988
mus musculus Olfr987 Q7TRA2 MEQSNDTKVTEFILLGFAGQHKSWHILFII ... Olfr987
mus musculus Olfr924 Q7TRB8 MNHSSVIDFILEGLTKRPELQLPLFLLFLA ... Olfr924
mus musculus Olfr904_Olfr916 Q8VG53 MDSVNISLVTEFILVGLTDKPYLQIPLFFI ... Olfr916
mus musculus Olfr911 A0A140T8K0 MGLENGSLVTEFILLGLTNDPDLQLPLFLL ... Olfr911-ps1
mus musculus Olfr902 E9Q6Z7 MDSVNVSLVTEFLLVGLTHQPDRQIPLFLL ... Olfr902
mus musculus Olfr828 Q8VFM8 MESKNQTDVSEFFLMGITDDIALKPLIFSM ... Olfr828