banner
sequences
Showing 1231 to 1246 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
mus musculus Olfr642 Q924X8 MRTLYSNTSSTLSFMLTGFPEMQSLEHWLA ... Olfr642
mus musculus Olfr686 Q8VGX3 MIFSNNSHLLPHTFFLTGIPGLTAAHVWIS ... Olfr686
mus musculus Olfr620 E9PZ66 MTALSVTNYTSSRFALTGFPGLEIYYFWIS ... Olfr620
mus musculus Olfr586 Q8VH13 M1-_H2-_T3-_G4- MSIFNLSVTEVSTFHLVGFPGMESAHIWIF ... Olfr586
mus musculus Olfr575 Q8VH16 MLVKSSIMSVLNSSEIEITTFFLIGIPGLE ... Olfr575
mus musculus Olfr609 E9Q4X7 MSYSNHSSTSFFLTGLPGLETVYLWLSIPL ... Olfr609
mus musculus Olfr74 A2BHP6 MILSEKNNSGIIFTLLVFSDYPDLKVPLFL ... Olfr74
mus musculus Olfr74 A2BHP6 A113S MILSEKNNSGIIFTLLVFSDYPDLKVPLFL ... Olfr74
mus musculus Olfr74 A2BHP6 F260Y MILSEKNNSGIIFTLLVFSDYPDLKVPLFL ... Olfr74
mus musculus Olfr73 Q920P2 S113A MTLSDGNHSGAVFTLLGFSDYPELTIPLFL ... Olfr73
mus musculus Olfr73 Q920P2 E208A MTLSDGNHSGAVFTLLGFSDYPELTIPLFL ... Olfr73
mus musculus Olfr73 Q920P2 Y260F MTLSDGNHSGAVFTLLGFSDYPELTIPLFL ... Olfr73
mus musculus Olfr73 Q920P2 S113A_E208A_Y260F MTLSDGNHSGAVFTLLGFSDYPELTIPLFL ... Olfr73
mus musculus Olfr74 A2BHP6 A208E MILSEKNNSGIIFTLLVFSDYPDLKVPLFL ... Olfr74
mus musculus Olfr74 A2BHP6 A113S_A208E_F260Y MILSEKNNSGIIFTLLVFSDYPDLKVPLFL ... Olfr74
homo sapiens OR8G2P Q6IF36 MVFLSSVETDQRKMSAGNHSSVTEFILAGL ... OR8G2