banner
sequences
Showing 1201 to 1230 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR4F3 Q6IEY1 V107I MDGENHSVVSEFLFLGLTHSWEIQLLLLVF ... hOR4F29_V107I
homo sapiens OR52L1 Q8NGH7 D88N MTLVSFFSFLSKPLIMLLSNSSWRLSQPSF ... hOR52L1_D88N
mus musculus Olfr1325 Q8VF43 MKKMNYQEIGNYTKVTEFILVGLSRHPTSQ ... Olfr1325
mus musculus Olfr812 Q8VG64 MKNQSGELEFILLGLTDDPQLQILIFLFLF ... Olfr812
mus musculus Olfr790 Q8VGJ3 MPLEAESIMRNSTAVTDFILLGLTDDPLWQ ... Olfr790
mus musculus Olfr214 Q8VG27 MAKEVEVRMKAWNETTVLEFVLEGFLVAQH ... Olfr214
mus musculus Olfr459 Q924H8 MMDNLSSATEFCLLGFPGSQELHYILFAIF ... Olfr459
mus musculus Olfr644 Q8VH21 MGGEAHNSSGLPPFILTGLPGMETSQHWLF ... Olfr644
mus musculus Olfr161 Q8VGB9 MGGTNQSSVSEFLLLGLSRQPQQQQQLIFL ... Olfr161
mus musculus Olfr24 Q8VFM9 MEPQNHTSASEFILLGLSEKPDHDPVLFSL ... Olfr24
mus musculus Olfr406 Q7TRX0 MARGNQTSTFEFLLWGLSEQPQQQHILFLI ... Olfr406
mus musculus Olfr356 Q8VFP5 MMTRNHSSVSEFLLLGLSEHWEQEPLLFGI ... Olfr356
mus musculus Olfr744 Q7TRM0 MKIFSSPSNSSTITGFILLGFPCPREGQIL ... Olfr744
mus musculus Olfr1356 Q7TQU8 MERENQTGERNFLLLGFTEDSDLQSFFFGL ... Olfr1356
mus musculus Olfr39 E9PVX1 MQRREASGMGKENHTELSQFLLLGLSDDPK ... Olfr39
mus musculus Olfr828 Q8VFM8 MESKNQTDVSEFFLMGITDDIALKPLIFSM ... Olfr828
mus musculus Olfr362 Q8VGV7 MSCAPNASHSPIFLLLGFSRAGVPHTFLFL ... Olfr362
mus musculus Olfr911 A0A140T8K0 MGLENGSLVTEFILLGLTNDPDLQLPLFLL ... Olfr911-ps1
mus musculus Olfr904_Olfr916 Q8VG53 MDSVNISLVTEFILVGLTDKPYLQIPLFFI ... Olfr916
mus musculus Olfr480 Q8VEZ0 MEPGNYTVVTEFILLGLTDDITVSVILFVM ... Olfr480
mus musculus Olfr902 E9Q6Z7 MDSVNVSLVTEFLLVGLTHQPDRQIPLFLL ... Olfr902
mus musculus Olfr69 Q9WVD7 MIKFNGSVFMPSVLTLVGIPGLESVQCWIG ... Olfr69
mus musculus Olfr616 Q3KPB0 MEITNSSWFQPPTLLLTGIPGLEDVQIWFC ... Olfr616
mus musculus Olfr1046 Q7TR79 MEKSNHSARIQVTEFILLGLTNNPGLKAPL ... Olfr1046
mus musculus Olfr1032 A2ATE5 MLNFTDVTEFILLGLTSRKELQVLFFVIFL ... Olfr1032
mus musculus Olfr613_Olfr614 Q3U0P3 MSDVNTTSNWPTFSFIGIPGLEAAHMWISI ... Olfr613
mus musculus Olfr683 Q8VGV1 M1-_I2-_R3-_R4-_Q5-_H6- MEAQSNTSSILAPDFLLICFPNYQTWQHWL ... Olfr683
mus musculus Olfr1098 A2AVB0 MSACNPTNEPEFMLVGLTDSKEIQLVLSVL ... Olfr1098
mus musculus Olfr1413 Q8VGU3 MATQVHRNGSLSAVSLQGFVLVGFGGGAKT ... Olfr1413
mus musculus Olfr488 Q8VG02 MAFLDNGNHTAVTEFILLGLTDDPFLRIVL ... Olfr600