banner
sequences
Showing 31 to 60 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR6K2 Q8NGY2 MESPNRTTIQEFIFSAFPYSWVKSVVCFVP ... hOR6K2
homo sapiens OR14A2_OR5AX1_OR5AX1P Q96R54 I314- MANVTLVTGFLLMGFSNIQKLRILYGVLFL ... hOR14A2
homo sapiens OR14K1_OR5AY1 Q8NGZ2 M312R_+315L MTNQTQMMEFLLVRFTENWVLLRLHALLFS ... hOR14K1
homo sapiens OR1C1 Q15619 MEKRNLTVVREFVLLGLPSSAEQQHLLSVL ... hOR1C1
homo sapiens OR6K3 Q8NGY3 T4A_P244S_P264L MCWAMPSPFTGSSTRNMESGNQSTVTEFIF ... hOR6K3_P228S_P248L
homo sapiens OR2T10 Q8NGZ9 MRLANQTLGGDFFLLGIFSQISHPGRLCLL ... hOR2T10
homo sapiens OR2T34 Q8NGX1 +1M_+2T_+3F_+4F_+5S_+6S_+7G_+8 ... MTFFSSGGNCEPVMCSGNQTSQNQTASTDF ... hOR2T34
homo sapiens OR2T11 Q8NH01 C119R_Q309R MTNTSSSDFTLLGLLVNSEAAGIVFTVILA ... hOR2T11_C119R_Q309R
homo sapiens OR2M4 Q96R27 MVWENQTFNSIFILLGIFNHSPTHTFLFSL ... hOR2M4
homo sapiens OR2M3_OR2M3P_OR2M6 Q8NG83 MARENSTFNSDFILLGIFNHSPTHTFLFFL ... hOR2M3
homo sapiens OR5H2 Q8NGV7 E16Q_I286V_+315C_+316G_+317R_+ ... MSNEDMEQDNTTLLTQFVLTGLTYQPEWKM ... hOR5H2
homo sapiens OR5H6 A0A126GV91 MFLYLCFIFQRTCSEEMEEENATLLTEFVL ... hOR5H6
homo sapiens OR2V2_OR2V3 Q96R30 H221R METWVNQSYTDGFFLLGIFSHSTADLVLFS ... hOR2V2_H221R
homo sapiens OR4F14 A0A126GV89 MVGANHSVVSEFVFLGLTNSWEIRLLLLVF ... hOR4F14_A297T
homo sapiens OR4F3 Q6IEY1 MDGENHSVVSEFLFLGLTHSWEIQLLLLVF ... hOR4F16
homo sapiens OR2H2_OR2H3 O95918 L30F_A48V MVNQSSTPGFLLLGFSEHPGLERTLFVVVF ... hOR2H2_L30F_A48V
homo sapiens OR11A1_OR11A2 Q9GZK7 MEIVSTGNETITEFVLLGFYDIPELHFLFF ... hOR11A1
homo sapiens OR2B3_OR2B3P O76000 MNWENESSPKEFILLGFSDRAWLQMPLFVV ... hOR2B3
homo sapiens OR10C1_OR10C2 Q96KK4 MSANTSMVTEFLLLGFSHLADLQGLLFSVF ... hOR10C1
homo sapiens OR2H2_OR2H3 O95918 V2D_L30F_+313G_+314E_+315L_+31 ... MDNQSSTPGFLLLGFSEHPGLERTLFVVVF ... hOR2H2
homo sapiens OR2W1 Q9Y3N9 MDQSNYSSLHGFILLGFSNHPKMEMILSGV ... hOR2W1
homo sapiens OR5K2 Q8NHB8 MVEENHTMKNEFILTGFTDHPELKTLLFVV ... hOR5K2
homo sapiens OR2Y1 Q8NGV0 V200L MGSFNTSFEDGFILVGFSDWPQLEPILFVF ... hOR2Y1_V200L
homo sapiens OR5V1 Q9UGF6 MERKNQTAITEFIILGFSNLNELQFLLFTI ... hOR5V1
homo sapiens OR12D3 Q9UGF7 MENVTTMNEFLLLGLTGVQELQPFFFGIFL ... hOR12D3
homo sapiens OR8D4 Q8NGM9 C120Y_R133K_F200L_L283P_R298K MGVKNHSTVTEFLLSGLTEQAELQLPLFCL ... hOR8D4_C120Y_R133K_F200L_L283P_R298K
homo sapiens OR2J2 O76002 H74Y_A146V_A218T MMIKKNASSEDFFILLGFSNWPQLEVVLFV ... hOR2J2_T111A
homo sapiens OR12D2 P58182 MLNTTSVTEFLLLGVTDIQELQPFLFVVFL ... hOR12D2
homo sapiens OR2B8P_OR2B8 P59922 T57N_V119A_M226V_L230S_D310-_S ... MDQKNGSSFTGFILLGFSDRPQLELVLFVV ... hOR2B8_Indel
homo sapiens OR2A7 Q96R45 T9R MGDNITSIREFLLLGFPVGPRIQMLLFGLF ... hOR2A7