banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR4C5 Q8NGB2 MYVSNCNPCAIHRKINYPNTKLDFEQVNNI ... hOR4C5
homo sapiens OR13D1 Q8NGV5 F21L_Q191H_S277L_+347E_+348R_+ ... MYRFTDFDVSNISIYLNHVLLYTTQQAGDL ... hOR13D1
homo sapiens OR13D1 Q8NGV5 MYRFTDFDVSNISIYLNHVLFYTTQQAGDL ... hOR13D1
homo sapiens OR51B4 Q9Y5P0 MWYNNSAGPFLLTGFLGSEAVHYRISMSFF ... hOR51B4
homo sapiens OR51B4 Q9Y5P0 M147T MWYNNSAGPFLLTGFLGSEAVHYRISMSFF ... hOR51B4_M147T
homo sapiens OR51B4 Q9Y5P0 V36I_M147T MWYNNSAGPFLLTGFLGSEAVHYRISMSFF ... hOR51B4_V36I_M147T
mus musculus Olfr64 Q9WVN5 MWSNISAAPFLLTGFPGLEAAHHWISIPFF ... MOR1-1
homo sapiens OR2AE1_OR2AE2 Q8NHA4 I77T MWQKNQTSLADFILEGLFDDSLTHLFLFSL ... hOR2AE1_I77T
homo sapiens OR2AE1_OR2AE2 Q8NHA4 MWQKNQTSLADFILEGLFDDSLTHLFLFSL ... hOR2AE1
homo sapiens OR2T1 O43869 MWQEYYFLNVFFPLLKVCCLTINSHVVILL ... hOR2T1
homo sapiens OR51B2_OR51B1P Q9Y5P1 MWPNITAAPFLLTGFPGLEAAHHWISIPFF ... hOR51B2
homo sapiens OR51B2_OR51B1P Q9Y5P1 C120R_C209S_P283S MWPNITAAPFLLTGFPGLEAAHHWISIPFF ... hOR51B2_C120R_C209S_P283S
homo sapiens OR10A4_OR10A4P Q9H209 R261Q_M1- MWENWTIVSEFVLVSFSALSTELQALLFLL ... hOR10A4_R262Q
homo sapiens OR2M4 Q96R27 MVWENQTFNSIFILLGIFNHSPTHTFLFSL ... hOR2M4
homo sapiens OR10C1_OR10C2 Q96KK4 F54L_P168Q_M240V_M1-_S2-_A3-_N ... MVTEFLLLGFSHLADLQGLLFSVFLTIYLL ... hOR10C1_F60L_P174Q_M246V
homo sapiens OR2A1 Q8NGT9 F273S_T277M_S284N_G288V_G299C_ ... MVTEFLLLGFLLGPRIQMLLFGLFSLFYIF ... hOR2A42
homo sapiens OR6K6 Q8NGW6 M1-_K2-_Q3-_Y4-_S5-_V6-_G7-_N8 ... MVTEFLFSMFPHAHRGGLLFFIPLLLIYGF ... hOR6K6
homo sapiens OR4F17_OR4F11P_OR4F18_OR4F19 Q8NGA8 Q293R MVTEFIFLGLSDSQGLQTFLFMLFFVFYGG ... hOR4F5
homo sapiens OR4F17_OR4F11P_OR4F18_OR4F19 Q8NGA8 MVTEFIFLGLSDSQGLQTFLFMLFFVFYGG ... hOR4F17
homo sapiens OR4F5 Q8NH21 MVTEFIFLGLSDSQELQTFLFMLFFVFYGG ... hOR4F5
homo sapiens OR4F5 Q8NH21 T141A_Q293R MVTEFIFLGLSDSQELQTFLFMLFFVFYGG ... hOR4F5_T141A_ Q293R
homo sapiens OR4F4 Q96R69 C221R MVTEFIFLGLSDSQELQTFLFMLFFVFYGG ... hOR4F4
homo sapiens OR4F17_OR4F11P_OR4F18_OR4F19 Q8NGA8 G15E MVTEFIFLGLSDSQELQTFLFMLFFVFYGG ... hOR4F17
homo sapiens OR4F4 Q96R69 MVTEFIFLGLSDSQELQTFLFMLFFVFYGG ... hOR4F4
mus musculus Olfr890_Olfr983 Q7TRA3 MVSENNSSVKEFILLGLTQLPELQLPLFFL ... MOR162-1
homo sapiens OR13C7_OR13C7P P0DN81 M49V_S77Y_K145M_A147V_L186Q_L2 ... MVSANQTASVTEFILLGLSAHPKLEKTFFV ... hOR13C7_Indel
homo sapiens OR13C7_OR13C7P P0DN81 MVSANQTASVTEFILLGLSAHPKLEKTFFV ... hOR13C7
homo sapiens OR2H2_OR2H3 O95918 MVNQSSTPGFLLLGFSEHPGLERTLFVVVL ... hOR2H2
homo sapiens OR2H2_OR2H3 O95918 L30F_A48V MVNQSSTPGFLLLGFSEHPGLERTLFVVVF ... hOR2H2_L30F_A48V
homo sapiens OR2H1_OR2H6_OR2H8 Q9GZK4 MVNQSSPMGFLLLGFSEHPALERTLFVVVF ... hOR2H1