banner
sequences
Showing 271 to 300 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR13D1 Q8NGV5 F21L_Q191H_S277L_+347E_+348R_+ ... MYRFTDFDVSNISIYLNHVLLYTTQQAGDL ... hOR13D1
canis lupus familiaris OR5K1 A0A8P0TCS6 MAEENHTLKSEFILTGFTDHPELKTLLFVV ... clOR5K1
homo sapiens OR13C3 Q8NGS6 G32C MIVQLICTVCFLAVNTFHVRSSFDFLKADD ... hOR13C3_G2C
homo sapiens OR5T3 Q8NGG3 +341E_+342R_+343P_+344L_+345E_ ... MDSTFTGYNLYNLQVKTEMDKLSSGLDIYR ... hOR5T3
homo sapiens OR5AL1_OR5AL1P P0C617 H195R_C205F_R309S_N310G_Q311R_ ... MCALKGFLEENFYTYSVAKGNHSTVYEFIL ... hOR5AL1
homo sapiens OR2T4 Q8NH00 M347-_E348- MDNITWMASHTGWSDFILMGLFRQSKHPMA ... hOR2T4
homo sapiens OR6K6 Q8NGW6 R159C_K343N MKQYSVGNQHSNYRSLLFPFLCSQMTQLTA ... hOR6K6
homo sapiens OR2G2 A0A126GVT7 MCYLSQLCLSLGEHTLHMGMVRHTNESNLA ... hOR2G2_P24A_V120L_R236G
homo sapiens OR1N2 Q8NGR9 W37R_V244G_T301M MEGFYLRRSHELQGMGKPGRVNQTTVSDFL ... hOR1N2_W37R_V244G_T301M
homo sapiens OR10C1_OR10C2 Q96KK4 F54L_P168Q_M240V_M1-_S2-_A3-_N ... MVTEFLLLGFSHLADLQGLLFSVFLTIYLL ... hOR10C1_F60L_P174Q_M246V
homo sapiens OR51G1_OR51G3P Q8NGK1 Y125S MTILLNSSLQRATFFLTGFQGLEGLHGWIS ... hOR51G1_Y125S
homo sapiens OR12D2 P58182 V47F_L56P_S104F_F113L_L120R_V1 ... MLNTTSVTEFLLLGVTDIQELQPFLFVVFL ... hOR12D2_V47F_L56P_S104F_F113L_L120R_V159I
homo sapiens OR1D2 P34982 MDGGNQSEGSEFLLLGMSESPEQQRILFWM ... hOR1D2
homo sapiens OR2M7 Q8NG81 MAWENQTFNSDFLLLGIFNHSPTHTFLFFL ... hOR2M7
mus musculus Olfr690 Q8VH18 MLGTNFTIIHPTVFILLGIPGLEQYHTWLS ... Olfr690
homo sapiens OR2M7 Q8NG81 F35L_V78A_C178F MAWENQTFNSDFLLLGIFNHSPTHTFLFFL ... hOR2M7_F35L_V78A_C178F
homo sapiens OR1L1_OR1L2 Q8NH94 M1-_E2-_R3-_N4-_H5-_N6-_P7-_D8 ... MGRNNLTRPSEFILLGLSSRPEDQKPLFAV ... hOR1L1
homo sapiens OR1A1 Q9P1Q5 T99M MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_T99M
homo sapiens OR1A1 Q9P1Q5 G108A MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_G108A
homo sapiens OR1A1 Q9P1Q5 N109K MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_N109K
homo sapiens OR2D3 Q8NGH3 L66I_M1-_C2-_S3-_F4-_F5-_L6-_C ... MGEENQTFVSKFIFLGLSQDLQTQILLFIL ... hOR2D3_L66I
homo sapiens OR2G3 Q8NGZ4 MGLGNESSLMDFILLGFSDHPRLEAVLFVF ... hOR2G3
homo sapiens OR1A1 Q9P1Q5 G108A_N109K MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_G108A_N109K
homo sapiens OR1A1 Q9P1Q5 T110A MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_T110A
homo sapiens OR1A1 Q9P1Q5 I114T MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1_I114T
homo sapiens OR5L1 Q8NGL2 MGKENCTTVAEFILLGLSDVPELRVCLFLL ... hOR5L1
homo sapiens OR1A2 Q9Y585 A108G MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_A108G
homo sapiens OR2G2 Q8NGZ5 P24A_L167P_R236G MGMVRHTNESNLAGFILLGFSDYAQLQKVL ... hOR2G2
homo sapiens OR2A4_OR2A10 O95047 MGDNITSIREFLLLGFPVGPRIQMLLFGLF ... hOR2A4
homo sapiens OR1A2 Q9Y585 K109N MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2_K109N