banner
sequences
Showing 181 to 210 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR10A6 Q8NH74 MERQNQSCVVEFILLGFSNYPELQGQLFVA ... hOR10A6
homo sapiens OR5B17_OR5B20P Q8NGF7 MENNTEVSEFILLGLTNAPELQVPLFIMFT ... hOR5B17
homo sapiens OR52P1_OR52P1P Q8NH57 N13H_Q110H_L172F_S231I_+1M_+2S ... MSSTLGHNMESPHHTDVDPSVFFLLGIPGL ... hOR52P1
homo sapiens OR56B4 Q8NH76 P277S MDTSTSVTYDSSLQISQFILMGLPGIHEWQ ... hOR56B4_P277S
homo sapiens OR4D6 Q8NGJ1 D96G MDQINHTNVKEFFFLELTRSRELEFFLFVV ... hOR4D6_D96G
homo sapiens OR8B8 Q15620 +1M_+2T MTMAAENSSFVTQFILAGLTDQPGVQIPLF ... hOR8B8
homo sapiens OR8B4_OR8B4P Q96RC9 E22G MTLRNSSSVTEFILVGLSEQPGLQLPLFLL ... hOR8B4_E22G
homo sapiens OR4C6 Q8NH72 MENQNNVTEFILLGLTENLELWKIFSAVFL ... hOR4C6
homo sapiens OR1L4_OR1L5 Q8NGR5 METKNYSSSTSGFILLGLSSNPKLQKPLFA ... hOR1L4
homo sapiens OR5D14 Q8NGL3 A244T_S249A_I307-_H308-_T309-_ ... MMMVLRNLSMEPTFALLGFTDYPKLQIPLF ... hOR5D14
homo sapiens OR6Q1 Q8NGQ2 MQPYTKNWTQVTEFVMMGFAGIHEAHLLFF ... hOR6Q1
homo sapiens OR52W1_OR52W1P Q6IF63 L254Q MAETLQLNSTFLHPNFFILTGFPGLGSAQT ... hOR52W1
homo sapiens OR2D2_OR2D1 Q9H210 MRQINQTQVTEFLLLGLSDGPHTEQLLFIV ... hOR2D2
homo sapiens OR2J1_OR2J1P Q9GZK6 MLMKKNASFEDFFLLLGFSNWPHLEVVLFV ... hOR2J1
homo sapiens OR5M11 Q96RB7 MSNTNGSAITEFILLGLTDCPELQSLLFVL ... hOR5M11
homo sapiens OR4C16 Q8NGL9 V25L_T76A_L259P MQLNNNVTEFILLGLTQDPFWKKILFVIFL ... hOR4C16_V25L_T76A_L259P
homo sapiens OR52N5 Q8NH56 MPLFNSLCWFPTIHVTPPSFILNGIPGLER ... hOR52N5
homo sapiens OR6X1 Q8NH79 MRNGTVITEFILLGFPVIQGLQTPLFIAIF ... hOR6X1
homo sapiens OR8B2 Q96RD0 MLARNNSLVTEFILAGLTDHPEFRQPLFFL ... hOR8B2
homo sapiens OR5J2 Q8NH18 MADDNFTVVTEFILLGLTDHAELKAVLFVV ... hOR5J2
homo sapiens OR8U1 Q8NH10 +1M_+2A_+3R_+4K_+5D MARKDMAHINCTQATEFILVGLTDHQELKM ... hOR8U1
homo sapiens OR4D11_OR4D11P Q8NGI4 MELGNVTRVKEFIFLGLTQSQDQSLVLFLF ... hOR4D11
homo sapiens OR4C11_OR4C11P Q6IEV9 MQQNNSVPEFILLGLTQDPLRQKIVFVIFL ... hOR4C11
homo sapiens OR5B2 Q96R09 M200T MENCTEVTKFILLGLTSVPELQIPLFILFT ... hOR5B2_M200T
homo sapiens OR10D3 Q8NH80 R197K_Y252-_G253-_P254-_I255-_ ... MEVKNCCMVTEFILLGIPHTEGLEMTLFVL ... hOR10D3_R197K_Y252*_V271M
homo sapiens OR5T1_OR5T1P Q8NG75 MSGLPSDMDLYKLQLNNFTEVTMFILISFT ... hOR5T1
homo sapiens OR10AG1 Q8NH19 MEFVLLGFSDIPNLHWMLFSIFLLMYLMIL ... hOR10AG1
homo sapiens OR8U1 Q8NH10 MAHINCTQATEFILVGLTDHQELKMPLFVL ... hOR8U1
homo sapiens OR6B3_OR6B3P Q8NGW1 MSGENVTRVGTFILVGFPTAPGLQYLLFLL ... hOR6B3
homo sapiens OR10A7 Q8NGE5 MICENHTRVTEFILLGFTNNPEMQVSLFIF ... hOR10A7