banner
sequences
Showing 211 to 240 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR10P1_OR10P1P_OR10P2P_OR10P3P Q8NGE3 P313- MAGENHTTLPEFLLLGFSDLKALQGPLFWV ... hOR10P1
homo sapiens OR2AP1_OR2AP1P Q8NGE2 MKNKTVLTEFILLGLTDVPELQVAVFTFLF ... hOR2AP1
homo sapiens OR1E1_OR1E5_OR1E6_OR1E9P P30953 S313-_L314- MMGQNQTSISDFLLLGLPIQPEQQNLCYAL ... hOR1E1
homo sapiens OR4K2 Q8NGD2 MDVGNKSTMSEFVLLGLSNSWELQMFFFMV ... hOR4K2
homo sapiens OR4K3_OR4K3P Q96R72 M69T_+1M_+2L_+3E_+4S_+5F_+6Q_+ ... MLESFQKSEQMAWSNQSAVTEFILRGLSSS ... hOR4K3
homo sapiens OR4K5 Q8NGD3 MDKSNSSVVSEFVLLGLCSSQKLQLFYFCF ... hOR4K5
homo sapiens OR4N5 Q8IXE1 METQNLTVVTEFILLGLTQSQDAQLLVFVL ... hOR4N5
homo sapiens OR11H4 Q8NGC9 V19M MSFFFVDLRPMNRSATHIMTEFILLGFPGC ... hOR11H4
homo sapiens OR4L1_OR4L2P Q8NH43 R52S MDLKNGSLVTEFILLGFFGRWELQIFFFVT ... hOR4L1_R52S
homo sapiens OR4K13 Q8NH42 MERANHSVVSEFILLGLSKSQNLQILFFLG ... hOR4K13
homo sapiens OR4K1 Q8NGD4 R89H MAHTNESMVSEFVLLGLSNSWGLQLFFFAI ... hOR4K1_R89H
homo sapiens OR4N2 Q8NGD1 MESENRTVIREFILLGLTQSQDIQLLVFVL ... hOR4N2
homo sapiens OR10A2_OR10A2P Q9H208 MSFSSLPTEIQSLLFLTFLTIYLVTLMGNC ... hOR10A2
homo sapiens OR6S1 Q8NH40 T42I_V156I_R237H MSPDGNHSSDPTEFVLAGLPNLNSARVELF ... hOR6S1_T42I_V156I_R237H
homo sapiens OR9Q2_OR9Q2P Q8NGE9 C135R_M1-_A2-_E3-_R4-_N5-_Y6-_ ... MILLIRGDRRLHTPMYFFLSHLSLVDICYS ... hOR9Q2_C179R
homo sapiens OR10G3 Q8NGC4 S73G MERINSTLLTAFILTGIPYPLRLRTLFFVF ... hOR10G3_S73G
homo sapiens OR4E2 Q8NGC2 V118M_Q234R MDSLNQTRVTEFVFLGLTDNRVLEMLFFMA ... hOR4E2_V118M_Q234R
homo sapiens OR11H6 Q8NGC7 MFFIIHSLVTSVFLTALGPQNRTMHFVTEF ... hOR11H6
homo sapiens OR4K14 Q8NGD5 MDPQNYSLVSEFVLHGLCTSRHLQNFFFIF ... hOR4K14
homo sapiens OR4N4 Q8N0Y3 MKIANNTVVTEFILLGLTQSQDIQLLVFVL ... hOR4N4
homo sapiens OR4M2B A0A0X1KG70 V239M_N277H_L279V_H284L_L303V METANYTKVTEFVLTGLSQTPEVQLVLFVI ... hOR4M2
homo sapiens OR8S1 Q8NH09 M48V_L82P_R128C_A198T_+297V_+2 ... MALGNHSTITEFLLLGLSADPNIRALLFVL ... hOR8S1_M48V_L82P_R128C_A198T
homo sapiens OR1F1 O43749 F75S MSGTNQSSVSEFLLLGLSRQPQQQHLLFVF ... hOR1F1_F75S
homo sapiens OR2C1 O95371 C149W MDGVNDSSLQGFVLMGISDHPQLEMIFFIA ... hOR2C1_C149W
homo sapiens OR4S1 Q8NGB4 MGAKNNVTEFVLFGLFESREMQHTCFVVFF ... hOR4S1
homo sapiens OR4C3 Q8NH37 +1M_+2Q_+3L_+4V_+5L_+6L_+7L_+8 ... MQLVLLLMFLLVFIGNTAPAFSVTLESMDI ... hOR4C3
homo sapiens OR4D2 P58180 C97S_L187F METGNLTWVSDFVFLGLSQTRELQRFLFLM ... hOR4D2_C97S_L187F
homo sapiens OR3A2 P47893 MSLQKLMEPEAGTNRTAVAEFILLGLVQTE ... hOR3A2
homo sapiens OR1D5 P58170 MDGDNQSENSQFLLLGISESPEQQRILFWM ... hOR1D5
homo sapiens OR7C2 A0A126GVS9 MERGNQTEVGNFLLLGFAEDSDMQLLLHGL ... hOR7C2