banner
sequences
Showing 241 to 270 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR10H5 Q8NGA6 A224D MQGLNHTSVSEFILVGFSAFPHLQLMLFLL ... hOR10H5_A224D
homo sapiens OR7G1_OR7G1P Q8NGA0 MGPRNQTAVSEFLLMKVTEDPELKLIPFSL ... hOR7G1
homo sapiens OR2Z1_OR2Z2 Q8NG97 MGDVNQSVASDFILVGLFSHSGSRQLLFSL ... hOR2Z1
homo sapiens OR7G3 Q8NG95 MKAGNFSDTPEFFLLGLSGDPELQPILFML ... hOR7G3
homo sapiens OR7D4_OR7D4P Q8NG98 MEAENLTELSKFLLLGLSDDPELQPVLFGL ... hOR7D4
homo sapiens OR7C1_OR7C4 O76099 S99G_V126I_E171K_S210P_V247L_I ... METGNQTHAQEFLLLGFSATSEIQFILFGL ... hOR7C1
homo sapiens OR7A17 O14581 MEPENDTGISEFVLLGLSEEPELQPFLFGL ... hOR7A17
homo sapiens OR11H12 A0A126GVV6 MCPLTLQVTGLMNVSEPNSSFAFVNEFILQ ... hOR11H12
homo sapiens OR10R2 Q8NGX6 A191T_E216G_L239F MPQILIFTYLNMFYFFPPLQILAENLTMVT ... hOR10R2_A191T_E216G_L239F
homo sapiens OR52B6 Q8NGF0 T57A_L111H_A167T_H170R_V288I MAQVRALHKIMALFSANSIGAMNNSDTRIA ... hOR52B6_T36A_L90H_A146T_H149R_V267I
homo sapiens OR4C5 Q8NGB2 F311L_+1M_+2N_+3N_+4I_+5A_+6Q_ ... MNNIAQLSLGFIDLGIPSVLQKIILTKIIL ... hOR4C5
homo sapiens OR7G2 A0A126GVU8 MPMQLLLTDFIIFSIRFIINSMEARNQTAI ... hOR7G2_V263A_F281V
ovis aries OR5K1 A0A6P3DZI2 MAKENHTIKNEFILTGFTDHPELKTLLFVV ... oaOR5K1
homo sapiens OR5T2 Q8NGG2 N333-_K334-_D335-_V336-_K337-_ ... MSYSIYKSTVNIPLSHGVVHSFCHNMNCNF ... hOR5T2
homo sapiens OR7E24_OR7E24P Q6IFN5 P242S MSYFPILFFFFLKRCPSYTEPQNLTGVSEF ... hOR7E24_P242S
homo sapiens OR4X1 A0A126GVZ7 MVATNNVTEIIFVGFSQNWSEQRVISVMFL ... hOR4X1_Indel
homo sapiens OR10X1_OR10X1P Q8NGY0 I3L_M1-_V2-_L3-_N4-_V5-_Y6-_C7 ... MKLNQTILKEFILVGFSVYPHVQTFLFVVF ... hOR10X1
homo sapiens OR1L6_OR1L7 Q8NGR2 Q59K MSYFYRLKLMKEAVLVKLPFTSLPLLLQTL ... OR1L6
homo sapiens OR4D1_OR4D3 Q15615 +1M_+2I_+3E_+4F_+5S_+6F_+7F_+8 ... MIEFSFFLFVCLFQWFLCRNVGEDPMEPQN ... hOR4D1
homo sapiens OR14J1_OR5U1 Q9UGF5 +1M_+2H_+3F_+4L_+5P_+6T_+7V_+8 ... MHFLPTVFGFLNRVTLGIFRETMVNLTSMS ... hOR14J1
homo sapiens OR2J1_OR2J1P Q9GZK6 M1-_L2- MKKNASFEDFFLLLGFSNWPHLEVVLFVVI ... hOR2J1
homo sapiens OR8G5_OR8G5P_OR8G6 Q8NG78 MIIYKQGITFLQKENNNTIHLNTMFFLSPA ... hOR8G5
homo sapiens OR52I2 Q8NH67 L25P_T167M MCQQILRDCILLIHHLCINRKKVSPVMLGP ... hOR52I2_T132M
homo sapiens OR51T1 A0A126GVU3 MTNKMYAIYIKNLNYFSFLIVQCLQPTMAI ... hOR51T1
homo sapiens OR2G3 Q8NGZ4 D60Y_+1M_+2N_+3S_+4L_+5G_+6K_+ ... MNSLGKLVSMILSAHVFCYSKFNCFGCTHS ... hOR2G3
homo sapiens OR51F2 Q8NH61 Y341-_E342- MTETSLSSQCFPMSVLNNTIAEPLIFLLMG ... hOR51F2
homo sapiens OR5AK3P_OR5AK3 Q8NH89 +1M_+2K_+3S_+4Q_+5I_+6E_+7K_+8 ... MKSQIEKSDLKYRAILLQKVTRMFLLFWVL ... hOR5AK3
homo sapiens OR5AK2 Q8NH90 M140I_+1M_+2N_+3N_+4T_+5I_+6V_ ... MNNTIVFVIKIQIEKSDLKYRAISLQEISK ... hOR5AK2_M92I
homo sapiens OR4C15 A0A126GVX1 MFSMTTEALNNFALGCTNLLMTMIPQIDLK ... hOR4C15
homo sapiens OR52B4 Q8NGK2 MPTVNHSGTSHTVFHLLGIPGLQDQHMWIS ... hOR52B4