banner
sequences
Showing 121 to 150 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR4C12 Q96R67 V283L MEKKKNVTEFILIGLTQNPIMEKVTFVVFL ... hOR4C12_V283L
homo sapiens OR4F17_OR4F11P_OR4F18_OR4F19 Q8NGA8 G15E MVTEFIFLGLSDSQELQTFLFMLFFVFYGG ... hOR4F17
homo sapiens OR8U3_OR5R1_OR5R1P Q8NH85 C122R_A274V_I320G_Y324- MAEVNIIYVTVFILKGITNRPELQAPCFGV ... hOR5R1
homo sapiens OR52K1 Q8NGK4 MLPSNITSTHPAVFLLVGIPGLEHLHAWIS ... hOR52K1
homo sapiens OR52D1 Q9H346 MSDSNLSDNHLPDTFFLTGIPGLEAAHFWI ... hOR52D1
homo sapiens OR51G1_OR51G3P Q8NGK1 MTILLNSSLQRATFFLTGFQGLEGLHGWIS ... hOR51G1
homo sapiens OR51A4 Q8NGJ6 G45C_L227P_R267G MSIINTSYVEITTFFLVGMPGLEYAHIWIS ... hOR51A4_G45C_L227P_R267G
homo sapiens OR2M5 Q8NH91 MTPGELALASGNHTPVTKFILQGFSNYPDL ... hOR2M5
homo sapiens OR56B1_OR56B1P Q8NGI3 C106R_S324- MNHMSASLKISNSSKFQVSEFILLGFPGIH ... hOR56B1_C106R
homo sapiens OR9G9 A0A126GVJ5 MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G9
homo sapiens OR10H4 Q8NGA5 MPSQNYSIISEFNLFGFSAFPQHLLPILFL ... hOR10H4
homo sapiens OR5D13 Q8NGL4 MMASERNQSSTPTFILLGFSEYPEIQVPLF ... hOR5DD
homo sapiens OR10H2 O60403 MLGLNHTSMSEFILVGFSAFPHLQLMLFLL ... hOR10H2
homo sapiens OR10A2_OR10A2P Q9H208 D167G_I240T MSFSSLPTEIQSLLFLTFLTIYLVTLMGNC ... hOR10A2
homo sapiens OR5AU1 Q8NGC0 MTEFHLQSQMPSIRLIFRRLSLGRIKPSQS ... hOR5AU1
homo sapiens OR8A1 Q8NGG7 MGFLSPMHPCRPPTQRRMAAGNHSTVTEFI ... hOR8A1
homo sapiens OR8B4_OR8B4P Q96RC9 MTLRNSSSVTEFILVGLSEQPELQLPLFLL ... hOR8B4
homo sapiens OR5D13 Q8NGL4 C62Y_R236L MMASERNQSSTPTFILLGFSEYPEIQVPLF ... hOR5D13_C62Y_R236L
homo sapiens OR4D10_OR4D10P Q8NGI6 MEMENCTRVKEFIFLGLTQNREVSLVLFLF ... hOR4D10
homo sapiens OR4S2_OR4S2P Q8NH73 MEKINNVTEFIFWGLSQSPEIEKVCFVVFS ... hOR4S2
homo sapiens OR10W1_OR10W1P Q8NGF6 R263Q MEFVFLAYPSCPELHILSFLGVSLVYGLII ... hOR10W1_R263Q
homo sapiens OR9Q2 A0A126GVG4 MRGWNHTGAKEFLLVGLTENPNLQIPLFLL ... hOR9Q2
homo sapiens OR8D2 Q9GZM6 MATSNHSSGAEFILAGLTQRPELQLPLFLL ... hOR8D2
homo sapiens OR9I1 Q8NGQ6 MAKNNLTRVTEFILMGFMDHPKLEIPLFLV ... hOR9I1
homo sapiens OR6B1 O95007 R143C_R309-_S310-_D311- MELENQTRVTKFILVGFPGSLSMRAAMFLI ... hOR6B1_R143C
homo sapiens OR6M1 Q8NGM8 MGNWSTVTEITLIAFPALLEIRISLFVVLV ... hOR6M1
homo sapiens OR52E2 Q8NGJ4 H174R_R264C MFLPNDTQFHPSSFLLLGIPGLETLHIWIG ... hOR52E2_H174R_R264C
homo sapiens OR5P2 Q8WZ92 MNSLKDGNHTALTGFILLGLTDDPILRVIL ... hOR5P2
homo sapiens OR51H1_OR51H1P Q8NH63 MTNLNASQANHRNFILTGIPGTPDKNPWLA ... hOR51H1
homo sapiens OR2B2_OR2B9 Q9GZK3 MNWVNKSVPQEFILLVFSDQPWLEIPPFVM ... hOR2B2