banner
sequences
Showing 151 to 180 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR5G3_OR5G3P_OR5G6P P0C626 MEDKNQTVVTEFLLLGLTDHPYQKIVLFFM ... hOR5G3
homo sapiens OR6T1 Q8NGN1 R317-_V318-_T319-_S320-_Q321-_ ... MNPENWTQVTSFVLLGFPSSHLIQFLVFLG ... hOR6T1
homo sapiens OR4B1 Q8NGF8 MASTSNVTELIFTGLFQDPAVQSVCFVVFL ... hOR4B1
homo sapiens OR51Q1 Q8NH59 +318R MSQVTNTTQEGIYFILTDIPGFEASHIWIS ... hOR51Q1
homo sapiens OR52N1 Q8NH53 R167C_F247I_F320Y MSFLNGTSLTPASFILNGIPGLEDVHLWIS ... hOR52N1
homo sapiens OR10G9_OR10G10P Q8NGN4 A90T_M134V MSKTSLVTAFILTGLPHAPGLDAPLFGIFL ... hOR10G9_A90T_M134V
homo sapiens OR4X2 Q8NGF9 MTEFIFLVLSPNQEVQRVCFVIFLFLYTAI ... hOR4X2
homo sapiens OR14C36_OR5BF1 Q8NHC7 MPNSTTVMEFLLMRFSDVWTLQILHSASFF ... hOR14CZ
homo sapiens OR5T3 Q8NGG3 MDSTFTGYNLYNLQVKTEMDKLSSGLDIYR ... hOR5T3
homo sapiens OR14J1_OR5U1 Q9UGF5 MVNLTSMSGFLLMGFSDERKLQILHALVFL ... hOR14J1
homo sapiens OR5M9 Q8NGP3 MPNFTDVTEFTLLGLTCRQELQVLFFVVFL ... hOR5M9
homo sapiens OR8K3 Q8NH51 L122R MEQHNLTTVNEFILTGITDIAELQAPLFAL ... hOR8K3_L122R
homo sapiens OR52E6 Q96RD3 MPIANDTQFHTSSFLLLGIPGLEDVHIWIG ... hOR52E6
homo sapiens OR1M1 Q8NGA1 +313Y_+314L_S313- MEPRNQTSASQFILLGLSEKPEQETLLFSL ... hOR1M1
homo sapiens OR51G2 Q8NGK0 G4R MTLRSLGNSSSSVSATFLLSGIPGLERMHI ... hOR51G2
homo sapiens OR10Q1 Q8NGQ4 E12D_Y77H_R191C MPVGKLVFNQSDPTEFVFRAFTTATEFQVL ... hOR10Q1
homo sapiens OR5D18 Q8NGL1 N136D MLLTDRNTSGTTFTLLGFSDYPELQVPLFL ... hOR5D18_N136D
homo sapiens OR51E2 Q9H255 MSSCNFTHATFVLIGIPGLEKAHFWVGFPL ... hOR51E2
homo sapiens OR51D1 Q8NGF3 MQKPQLLVPIIATSNGNLVHAAYFLLVGIP ... hOR51D1
homo sapiens OR5AR1 Q8NGP9 MDKENSSMVTEFIFMGITQDPQMEIIFFVV ... hOR5AR1
homo sapiens OR5M1 Q8NGP8 S282T MFSPNHTIVTEFILLGLTDDPVLEKILFGV ... hOR5M1_S282T
homo sapiens OR5AP2 Q8NGF4 +1M MMRLMKEVRGRNQTEVTEFLLLGLSDNPDL ... hOR5AP2
homo sapiens OR52B2 Q96RD2 +324E_+325R_+326P_+327L_+328E_ ... MSHTNVTIFHPAVFVLPGIPGLEAYHIWLS ... hOR52B2
homo sapiens OR52K2 Q8NGK3 MSASNITLTHPTAFLLVGIPGLEHLHIWIS ... hOR52K2
homo sapiens OR8I2 Q8N0Y5 +311E_+312R_+313P_+314L_+315E_ ... MAGNNFTEVTVFILSGFANHPELQVSLFLM ... hOR8I2
homo sapiens OR8H2 Q8N162 A105V_I154M_V158L_Y169C_D170Y_ ... MMGRRNNTNVADFILMGLTLSEEIQMALFM ... hOR8H2_A105V_I154M_V158L_Y169C_D170Y_Y259H_V284M
bos taurus OR5K1 E1BM68 MAKENHTIKSEFILTGFTDHPELKTLLFVV ... btOR5K1
homo sapiens OR8H3 Q8N146 P137S MMGRRNDTNVADFILTGLSDSEEVQMALFM ... hOR8H3_P137S
homo sapiens OR4A15 Q8NGL6 A257V_M1-_E2-_L3-_L4-_T5-_N6-_ ... MKNKNNVTEFILLGLTQNPEGQKVLFVTFL ... hOR4A15_A257V
homo sapiens OR4D9 Q8NGE8 MDQRNYTRVKEFTFLGITQSRELSQVLFTF ... hOR4D9