banner
sequences
Showing 61 to 90 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR2A1 A0A126GVC1 MGENQTMVTEFLLLGFLLGPRIQMLLFGLF ... hOR2A1
homo sapiens OR2AE1_OR2AE2 Q8NHA4 I77T MWQKNQTSLADFILEGLFDDSLTHLFLFSL ... hOR2AE1_I77T
homo sapiens OR9A2 Q8NGT5 R298Q MMDNHSSATEFHLLGFPGSQGLHHILFAIF ... hOR9A2
homo sapiens OR9A4 Q8NGU2 MLMNYSSATEFYLLGFPGSEELHHILFAIF ... hOR9A4
homo sapiens OR2F1_OR2F3_OR2F3P_OR2F4_OR2F5 Q13607 MGTDNQTWVSEFILLGLSSDWDTRVSLFVL ... hOR2F1
homo sapiens OR2A14_OR2A14P_OR2A6 Q96R47 MEGNKTWITDITLPRFQVGPALEILLCGLF ... hOR2A14
homo sapiens OR2A12_OR2A12P Q8NGT7 MESNQTWITEVILLGFQVDPALELFLFGFF ... hOR2A12
homo sapiens OR2F2 O95006 A98V MEIDNQTWVREFILLGLSSDWCTQISLFSL ... hOR2F2_A98V
homo sapiens OR1L8 Q8NGR8 MERINHTSSVSEFILLGLSSRPEDQKTLFV ... hOR1L8
homo sapiens OR1K1 Q8NGR3 MEAANESSEGISFVLLGLTTSPGQQRPLFV ... hOR1K1
homo sapiens OR1L3 Q8NH93 MGMSNLTRLSEFILLGLSSRSEDQRPLFAL ... hOR1L3
homo sapiens OR13C4 Q8NGS5 MDKINQTFVREFILLGLSGYPKLEIIFFAL ... hOR13C4
homo sapiens OR13C8 Q8NGS7 MERTNDSTSTEFFLVGLSAHPKLQTVFFVL ... hOR13C8
homo sapiens OR13C9 Q8NGT0 F197L MEWENQTILVEFFLKGHSVHPRLELLFFVL ... hOR13C9_F197L
homo sapiens OR13F1 Q8NGS4 F18S_M101V_V134I_I270T MFPANWTSVKVFFFLGFSHYPKVQVIIFAV ... hOR13F1_F18S_M101V_V134I_I270T
homo sapiens OR13J1 Q8NGT2 H133R MEPLNRTEVSEFFLKGFSGYPALEHLLFPL ... hOR13J1_H133R
homo sapiens OR13C7_OR13C7P P0DN81 M49V_S77Y_K145M_A147V_L186Q_L2 ... MVSANQTASVTEFILLGLSAHPKLEKTFFV ... hOR13C7_Indel
homo sapiens OR1L4_OR1L5 Q8NGR5 G234R METKNYSSSTSGFILLGLSSNPKLQKPLFA ... hOR1L4_G234R
homo sapiens OR1Q1_OR1Q2_OR1Q3 Q15612 Q24R_I163M MDNSNWTSVSHFVLLGISTHPEERIPLFLV ... hOR1Q1_Q24R_I163M
homo sapiens OR7A10 O76100 MKSWNNTIILEFLLLGISEEPELQAFLFGL ... hOR7A10
homo sapiens OR13A1 Q8NGR1 MKLWMESHLIVPETRPSPRMMSNQTLVTEF ... hOR13A1
homo sapiens OR10G6_OR10G6P Q8NH81 MLEGVEHLLLLLLLTDVNSKELQSGNQTSV ... hOR10G6
homo sapiens OR9G4 Q8NGQ1 N206D MIFPSHDSQAFTSVDMEVGNCTILTEFILL ... hOR9G4_N191D
homo sapiens OR9G9 P0C7N8 C193G MQRSNHTVTEFILLGFTTDPGMQLGLFVVF ... hOR9G1
homo sapiens OR2AG1_OR2AG3 Q9H205 MELWNFTLGSGFILVGILNDSGSPELLCAT ... hOR2AG1
homo sapiens OR52E1_OR52E1P Q8NGJ3 L114I_Y278C MNTTLFHPYSFLLLGIPGLESMHLWVGFPF ... hOR52E1
homo sapiens OR56A1 Q8NGH5 MIQPMASPSNSSTVPVSEFLLICFPNFQSW ... hOR56A1
homo sapiens OR5P3 Q8WZ94 MGTGNDTTVVEFTLLGLSEDTTVCAILFLV ... hOR5P3
homo sapiens OR52L1 Q8NGH7 D88N_C140R_C161R_K183T_W297R MTLVSFFSFLSKPLIMLLSNSSWRLSQPSF ... hOR52L1_D73N_C125R_C146R_K168T_W282R
homo sapiens OR52L2P_OR52L2 Q8NGH6 S76P_R169W_R311G MNLDSFFSFLLKSLIMALSNSSWRLPQPSF ... hOR52L2_R169W