banner
sequences
Showing 91 to 120 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR52J3 Q8NH60 T77A_V128I_Q141L_V226I_R303-_V ... MFYHNKSIFHPVTFFLIGIPGLEDFHMWIS ... hOR52J3_T77A_V128I_Q141L_V226I_R303*
homo sapiens OR10G4 Q8NGN3 A9V_M134V_V195E_R235G_K295Q MSNASLVTVFILTGLPHAPGLDALLFGIFL ... hOR10G4_A9V_M134V_V195E_R235G_K295Q
homo sapiens OR51M1 Q9H341 H102Q_L135F_I204T_P256H_F318L MSVQYSLSPQFMLLSNITQFSPIFYLTSFP ... hOR51M1_H91Q_L124F_I193T_P245H_F307L
homo sapiens OR4D5 Q8NGN0 MNPANHSQVAGFVLLGLSQVWELRFVFFTV ... hOR4D5
homo sapiens OR52E4 Q8NGH9 V176I_R184M_R228H MPSINDTHFYPPFFLLLGIPGLDTLHIWIS ... hOR52E4_V176I_R184M_R228H
homo sapiens OR52E5 Q8NH55 P234L MLHTNNTQFHPSTFLVVGVPGLEDVHVWIG ... hOR52E5_P234L
homo sapiens OR5M10 Q6IEU7 V69L MLSPNHTIVTEFILLGLTDDPVLEKILFGV ... hOR5M10_V69L
homo sapiens OR52N4 Q8NGI2 T106I_L167R_N218I MLTLNKTDLIPASFILNGVPGLEDTQLWIS ... hOR52N4_T106I_L167R_N218I
homo sapiens OR56A3_OR56A3P_OR56A6 Q8NH54 M51T MTTHRNDTLSTEASDFLLNCFVRSPSWQHW ... hOR56A3_M51T
homo sapiens OR51E1_OR51E1P_OR52A3P Q8TCB6 +1M MMVDPNGNESSATYFILIGLPGLEEAQFWL ... hOR51E1
homo sapiens OR5A1_OR5A1P Q8NGJ0 I16N_I52V_L197H_R310S_K311G_K3 ... MSITKAWNSSSVTMFNLLGFTDHPELQALL ... hOR5A1
homo sapiens OR5A1_OR5A1P Q8NGJ0 I52V_R310-_K311-_K312-_V313-_F ... MSITKAWNSSSVTMFILLGFTDHPELQALL ... hOR5A1_I52V
homo sapiens OR5A2 Q8NGI9 MAVGRNNTIVTKFILLGLSDHPQMKIFLFM ... hOR5A2
homo sapiens OR51I2 Q9H344 MGLFNVTHPAFFLLTGIPGLESSHSWLSGP ... hOR51I2
homo sapiens OR5AS1 Q8N127 MLESNYTMPTEFLFVGFTDYLPLRVTLFLV ... hOR5AS1
homo sapiens OR1S2 Q8NGQ3 I59T MKTLCSFLQISRNMHQENQTTITEFILLGL ... hOR1S2_I46T
homo sapiens OR10H1 Q9Y4A9 MQRANHSTVTQFILVGFSVFPHLQLMLFLL ... hOR10H1
homo sapiens OR5B3_OR5B13 Q8NH48 MENKTEVTQFILLGLTNDSELQVPLFITFP ... hOR5B3
homo sapiens OR4P4_OR4P3P Q8NGL7 +1M_+2S_+3F_+4Q_+5V_+6T_+7Y_+8 ... MSFQVTYMFYLHWTMEKSNNSTLFILLGFS ... hOR4P4
homo sapiens OR8D1_OR8D3 Q8WZ84 MTMENYSMAAQFVLDGLTQQAELQLPLFLL ... hOR8D1
homo sapiens OR1A2 Q9Y585 MKKENQSFNLDFILLGVTSQQEQNNVFFVI ... hOR1A2
homo sapiens OR6T1 Q8NGN1 MNPENWTQVTSFVLLGFPSSHLIQFLVFLG ... hOR6T1
homo sapiens OR52M1_OR52M1P Q8NGK5 M314K MLTFHNVCSVPSSFWLTGIPGLESLHVWLS ... hOR52M1
homo sapiens OR5I1 Q13606 MEFTDRNYTLVTEFILLGFPTRPELQIVLF ... hOR5I1
homo sapiens OR5F1 O95221 S294N MTRKNYTSLTEFVLLGLADTLELQIILFLF ... hOR5F1_S294N
homo sapiens OR8J3 Q8NGG0 MAPENFTRVTEFILTGVSSCPELQIPLFLV ... hOR8J3
homo sapiens OR8K5 Q8NH50 T49A_M118V MGQHNLTVLTEFILMELTRRPELQIPLFGV ... hOR8K5
homo sapiens OR52I2 Q8NH67 MCQQILRDCILLIHHLCINRKKVSLVMLGP ... hOR52I2
homo sapiens OR52A1 Q9UKL2 S272P MSISNITVYMPSVLTLVGIPGLESVQCWIG ... hOR52A1_S272P
homo sapiens OR52E8 Q6IFG1 MAGRMSTSNHTQFHPSSFLLLGIPGLEDVH ... hOR52E8