banner
sequences
Showing 1 to 30 of 1246 results
 
Species
Gene Name
UniProt ID
Mutation
Sequence
Org. Gene ID
homo sapiens OR10S1 Q8NGN2 MTSRSVCEKMTMTTENPNQTVVSHFFLEGL ... OR10S1
mus musculus Olfr175_Olfr175 A0A140T8K4 MTEDNYSLTTEFILIGFSDHPDLKILLFLV ... Olfr175
mus musculus Olfr1440 Q8VFV4 MPGGRNSTVITKFILVGFSDFPKLKLVLFV ... mOR215-1
homo sapiens OR2A1 Q8NGT9 MGENQTMVTEFLLLGFLLGPRIQMLLFGLF ... OR2A42
homo sapiens OR2A7 Q96R45 MGDNITSITEFLLLGFPVGPRIQMLLFGLF ... OR2A7
homo sapiens OR2L13_OR2L14 Q8N349 MEKWNHTSNDFILLGLLPPNQTGIFLLCLI ... OR2L13
homo sapiens OR5AN1 Q8NGI8 MTGGGNITEITYFILLGFSDFPRIIKVLFT ... hOR5AN1
homo sapiens OR2T4 Q8NH00 MDNITWMASHTGWSDFILMGLFRQSKHPMA ... OR2T4
homo sapiens OR2W3_OR2W3P_OR2W8P Q7Z3T1 MDGTNGSTQTHFILLGFSDRPHLERILFVV ... OR2W3
homo sapiens OR51B5 Q9H339 MSSSGSSHPFLLTGFPGLEEAHHWISVFFL ... OR51B5
mus musculus Olfr180 Q7TS48 MEKTNHSLTTQFILVGFSDHPDLKTPLFLL ... Olfr180
homo sapiens OR10K1 Q8NGX5 MEQVNKTVVREFVVLGFSSLARLQQLLFVI ... hOR10K1
homo sapiens OR6Y1_OR6Y2 Q8NGX8 V252I MTTIILEVDNHTVTTRFILLGFPTRPAFQL ... hOR6Y1_V252I
homo sapiens OR10Z1 Q8NGY1 MGQTNVTSWRDFVFLGFSSSGELQLLLFAL ... hOR10Z1
homo sapiens OR6N2 Q8NGY6 MDQYNHSSLAEFVFLGFASVGYVRGWLFVL ... hOR6N2
homo sapiens OR14C36_OR5BF1 Q8NHC7 G225R_D231Y MPNSTTVMEFLLMRFSDVWTLQILHSASFF ... hOR14C36_G225R_D231Y
homo sapiens OR14L1_OR14L1P_OR5AV1P Q8NHC6 M1-_S2-_P3-_D4-_T5-_F6-_L7-_K8 ... MGFSNSWDIQIVHAALFFLVYLAAVIGNLL ... hOR14L1
homo sapiens OR14A16 A0A126GV53 MANLTIVTEFILMGFSTNKNMCILHSILFL ... hOR14A16_Indel
homo sapiens OR11L1 Q8NGX0 G108S_F117L_A142T_R171P MEPQNTSTVTNFQLLGFQNLLEWQALLFVI ... hOR11L1_G108S_F117L_A142T_R171P
homo sapiens OR4A5 Q8NH83 T8S_Y33H_D46T_M57V_G82D_F84L_Q ... MRQNNNISEFVLLGFSQDPGVQKALFVMFL ... hOR1S2
homo sapiens OR10T2 Q8NGX3 MRGFNKTTVVTQFILVGFSSLGELQLLLFV ... hOR10T2
homo sapiens OR2T29 Q8NH02 Q24R_F154S_V229I_E236A MANITRMANHTGRLDFILMGLFRRSKHPAL ... hOR2T5
homo sapiens OR6P1 Q8NGX9 MRNLSGGHVEEFVLVGFPTTPPLQLLLFVL ... hOR6P1
homo sapiens OR13G1 Q8NGZ3 I132V MNHSVVTEFIILGLTKKPELQGIIFLFFLI ... hOR13G1_I132V
homo sapiens OR10J5 Q8NHC4 MKRKNFTEVSEFIFLGFSSFGKHQITLFVV ... hOR10J5
mus musculus Olfr544 E9PX47 MSGWSNGTYNESYTSFLLMGFPGMQEARAL ... Olfr544
homo sapiens OR6N1 Q8NGY5 I194T_F245L_Q261R_R293H MDTGNWSQVAEFIILGFPHLQGVQIYLFLL ... hOR6N1_I194T_F245L_Q261R_R293H
homo sapiens OR6F1 Q8NGZ6 MDTGNKTLPQDFLLLGFPGSQTLQLSLFML ... hOR6F1
homo sapiens OR1A1 Q9P1Q5 MRENNQSSTLEFILLGVTGQQEQEDFFYIL ... hOR1A1
homo sapiens OR10K2 Q6IF99 MERVNETVVREVIFLGFSSLARLQQLLFVI ... hOR10K2